Asialoglycoprotein Receptor 1, Recombinant, Rat, aa61-284, His-Tag

Produktübersicht

• Artikelname: Asialoglycoprotein Receptor 1, Recombinant, Rat, aa61-284, His-Tag
• Artikelnummer: USB-583684
• Hersteller Artikelnummer: 583684
• Alternativnummer: USB-583684-20,USB-583684-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Source: Recombinant protein corresponding to aa61-284 from rat Asialoglycoprotein receptor 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.1kD Amino Acid Sequence: QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 30.1
• UniProt: P02706
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.