Asialoglycoprotein Receptor 1, Recombinant, Rat, aa61-284, His-Tag, Myc-Tag

Artikelnummer: USB-583686
Artikelname: Asialoglycoprotein Receptor 1, Recombinant, Rat, aa61-284, His-Tag, Myc-Tag
Artikelnummer: USB-583686
Hersteller Artikelnummer: 583686
Alternativnummer: USB-583686-20,USB-583686-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Source: Recombinant protein corresponding to aa61-284 from rat Asialoglycoprotein receptor 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~31kD Amino Acid Sequence: QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31
UniProt: P02706
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.