Bet v 1 Related Allergen, Recombinant, Actinidia deliciosa, aa1-157, His-SUMO-Tag

Produktübersicht

• Artikelname: Bet v 1 Related Allergen, Recombinant, Actinidia deliciosa, aa1-157, His-SUMO-Tag
• Artikelnummer: USB-583760
• Hersteller Artikelnummer: 583760
• Alternativnummer: USB-583760-20,USB-583760-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-157 from Actinidia deliciosa Bet v 1 related allergen, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.9kD Amino Acid Sequence: MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.9
• UniProt: D1YSM5
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.