Beta-casein, Recombinant, Bovine, aa16-224, His-Tag, Myc-Tag

Artikelnummer: USB-583767
Artikelname: Beta-casein, Recombinant, Bovine, aa16-224, His-Tag, Myc-Tag
Artikelnummer: USB-583767
Hersteller Artikelnummer: 583767
Alternativnummer: USB-583767-20,USB-583767-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Important role in determination of the surface properties of the casein micelles. Source: Recombinant protein corresponding to aa16-224 from bovine Beta-casein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.6kD Amino Acid Sequence: RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.6
UniProt: P02666
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.