Beta-defensin 6, Recombinant, Mouse, aa23-63, His-KSI-Tag

Artikelnummer: USB-583775
Artikelname: Beta-defensin 6, Recombinant, Mouse, aa23-63, His-KSI-Tag
Artikelnummer: USB-583775
Hersteller Artikelnummer: 583775
Alternativnummer: USB-583775-20,USB-583775-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has potent antibacterial activity against E.coli (ATCC 25922). Source: Recombinant protein corresponding to aa23-63 from mouse Beta-defensin 6, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.8kD Amino Acid Sequence: QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.8
UniProt: Q91VD6
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.