Beta-lactamase CTX-M-2, Recombinant, Salmonella typhimurium, aa29-291

Artikelnummer: USB-583783
Artikelname: Beta-lactamase CTX-M-2, Recombinant, Salmonella typhimurium, aa29-291
Artikelnummer: USB-583783
Hersteller Artikelnummer: 583783
Alternativnummer: USB-583783-20,USB-583783-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has cefotaxime-hydrolyzing activity. Source: Recombinant protein corresponding to aa29-291 from Salmonella typhimurium Beta-lactamase CTX-M-2, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: QANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAESRRDILAAAAKIVTHGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.4
UniProt: P74841
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.