Beta-lactamase SHV-3, Recombinant, Klebsiella pneumoniae, aa22-286, His-Tag

Artikelnummer: USB-583787
Artikelname: Beta-lactamase SHV-3, Recombinant, Klebsiella pneumoniae, aa22-286, His-Tag
Artikelnummer: USB-583787
Hersteller Artikelnummer: 583787
Alternativnummer: USB-583787-20,USB-583787-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This enzyme hydrolyzes cefotaxime, ceftazidime and other broad spectrum cephalosporins. Source: Recombinant protein corresponding to aa22-286 from Klebsiella pneumoniae Beta-lactamase SHV-3, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.0kD Amino Acid Sequence: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQLQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33
UniProt: P30896
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.