Beta-tectorin, Recombinant, Mouse, aa18-305, His-Tag

Artikelnummer: USB-583797
Artikelname: Beta-tectorin, Recombinant, Mouse, aa18-305, His-Tag
Artikelnummer: USB-583797
Hersteller Artikelnummer: 583797
Alternativnummer: USB-583797-20,USB-583797-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The cDNA fragment encoding aa18-305 of Mouse Beta-tectorin/Tectb was fused with an N-terminal 6xHis-Tag and then expressed in vitro E.coli expression system. The product obtained is the Recombinant full-length of mature Mouse Tectb protein. Its purity was determined by using SDS-PAGE and reached up to 90%. On the reducing SDS-PAGE gel, there presented a molecular mass band of about 38kD. The slightly higher result was attributed to glycosylation. This recombinant Tectb protein may be used for specific antibody production or on the studies of the tectorial membrane (TM). Tectb is a non-collagenous glycoprotein localized to the TM. It is exclusively highly expressed in the inner ear. The absence of Tecb impairs TMs core structure and significantly alters the cochlear function. Remarkable sensitivity and exquisite frequency selectivity are hallmarks of mammalian hearing. Roozbeh Ghaffari etc. demonstrated that Tectb mutation-mediated the reduction of the spatial extent and propagation velocity of TM traveling waves is probably responsible for all the hearing abnormalities related to the mutation. The deletion of the tectb gene in the mouse model showed reduced sensitivity and sharper frequency selectivity. One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Source: Recombinant protein corresponding to aa18-305 from mouse Beta-tectorin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~36.5kD Amino Acid Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.5
UniProt: O08524
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.