Blood Group Rh(CE) Polypeptide, Recombinant, Human, aa379-417, His-KSI-Tag

Artikelnummer: USB-583808
Artikelname: Blood Group Rh(CE) Polypeptide, Recombinant, Human, aa379-417, His-KSI-Tag
Artikelnummer: USB-583808
Hersteller Artikelnummer: 583808
Alternativnummer: USB-583808-20,USB-583808-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Source: Recombinant protein corresponding to aa379-417 from human Blood group Rh(CE) polypeptide, fused to 6X His-KSI-Tag, expressed in E.coli. Molecular Weight: ~19.8kD Amino Acid Sequence: TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.8
UniProt: P18577
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.