Bone Marrow Proteoglycan, Recombinant, Human, aa17-104, His-GST-Tag

Produktübersicht

• Artikelname: Bone Marrow Proteoglycan, Recombinant, Human, aa17-104, His-GST-Tag
• Artikelnummer: USB-583811
• Hersteller Artikelnummer: 583811
• Alternativnummer: USB-583811-20,USB-583811-100,USB-583811-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Source: Recombinant protein corresponding to aa17-104 from human Bone marrow proteoglycan, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.2kD Amino Acid Sequence: LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.2
• UniProt: P13727
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.