Bone Morphogenetic Protein 15, Recombinant, Human, aa268-392, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Bone Morphogenetic Protein 15, Recombinant, Human, aa268-392, His-Tag, Myc-Tag
• Artikelnummer: USB-583812
• Hersteller Artikelnummer: 583812
• Alternativnummer: USB-583812-20,USB-583812-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth. Source: Recombinant protein corresponding to aa268-392 from human Bone morphogenetic protein 15, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~21.4kD Amino Acid Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.4
• UniProt: O95972
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.