Breast Cancer Metastasis-suppressor 1-like Protein, Recombinant, Human, aa1-323, His-Tag

Produktübersicht

• Artikelname: Breast Cancer Metastasis-suppressor 1-like Protein, Recombinant, Human, aa1-323, His-Tag
• Artikelnummer: USB-583826
• Hersteller Artikelnummer: 583826
• Alternativnummer: USB-583826-20,USB-583826-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Involved in the histone deacetylase (HDAC1)-dependent transcriptional repression activity. When overexpressed in lung cancer cell line that lacks p53/TP53 expression, inhibits cell growth. Source: Recombinant protein corresponding to aa1-323 from human Breast cancer metastasis-suppressor 1-like protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.7kD Amino Acid Sequence: MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.7
• UniProt: Q5PSV4
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.