C-C Chemokine receptor Type 4, Recombinant, Human, aa309-360, His-SUMO-Tag

Produktübersicht

• Artikelname: C-C Chemokine receptor Type 4, Recombinant, Human, aa309-360, His-SUMO-Tag
• Artikelnummer: USB-583832
• Hersteller Artikelnummer: 583832
• Alternativnummer: USB-583832-20,USB-583832-100,USB-583832-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

High affinity receptor for the C-C type chemokines CCL17/TARC, CCL22/MDC and CKLF isoform 1/CKLF1. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival. Partial recombinant protein corresponding to aa309-360 from human C-C chemokine receptor type 4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Swiss/Uniprot: P51679 Molecular Weight: ~19.0kD Amino Acid Sequence: EKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19
• UniProt: P51679
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.