C-C Motif Chemokine 1, Recombinant, Human, aa24-96, His-HA-Tag

Artikelnummer: USB-583838
Artikelname: C-C Motif Chemokine 1, Recombinant, Human, aa24-96, His-HA-Tag
Artikelnummer: USB-583838
Hersteller Artikelnummer: 583838
Alternativnummer: USB-583838-20,USB-583838-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. Source: Recombinant protein corresponding to aa24-96 from human C-C motif chemokine 1, fused to 10X His-HA-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~11.1kD Amino Acid Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.1
UniProt: P22362
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.