C-type Lectin-like Domain Family 1, Recombinant, Human, aa89-167, His-Tag, Myc-Tag

Artikelnummer: USB-583853
Artikelname: C-type Lectin-like Domain Family 1, Recombinant, Human, aa89-167, His-Tag, Myc-Tag
Artikelnummer: USB-583853
Hersteller Artikelnummer: 583853
Alternativnummer: USB-583853-20
Hersteller: US Biological
Kategorie: Molekularbiologie
May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response. Source: Recombinant protein corresponding to aa89-167 from human C-type lectin-like domain family 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~13kD Amino Acid Sequence: KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13
UniProt: Q8IZS7
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.