C-X-C Chemokine Receptor Type 3, Recombinant, Human, aa4-50, His-GST-Tag

Artikelnummer: USB-583855
Artikelname: C-X-C Chemokine Receptor Type 3, Recombinant, Human, aa4-50, His-GST-Tag
Artikelnummer: USB-583855
Hersteller Artikelnummer: 583855
Alternativnummer: USB-583855-20,USB-583855-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Isoform 1. Source: Recombinant protein corresponding to aa4-50 from human C-X-C chemokine receptor type 3, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~36.6kD Amino Acid Sequence: EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.6
UniProt: P49682
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.