C-X-C Motif Chemokine 10, Recombinant, Human, aa22-98, His-Tag

Produktübersicht

• Artikelname: C-X-C Motif Chemokine 10, Recombinant, Human, aa22-98, His-Tag
• Artikelnummer: USB-583859
• Hersteller Artikelnummer: 583859
• Alternativnummer: USB-583859-20,USB-583859-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from human C-X-C motif chemokine 10, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~10.6kD Amino Acid Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 10.6
• UniProt: P02778
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.