Calcium/Calmodulin-dependent Protein Kinase II Inhibitor 1, Recombinant, Human, aa1-78, His-Trx-Tag

Produktübersicht

• Artikelname: Calcium/Calmodulin-dependent Protein Kinase II Inhibitor 1, Recombinant, Human, aa1-78, His-Trx-Tag
• Artikelnummer: USB-583870
• Hersteller Artikelnummer: 583870
• Alternativnummer: USB-583870-20,USB-583870-100,USB-583870-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Potent and specific inhibitor of CaM-kinase II (CAMK2). Source: Recombinant protein corresponding to aa1-78 from human Calcium/calmodulin-dependent protein kinase II inhibitor 1, fused to 6X His-Trx-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.6kD Amino Acid Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.6
• UniProt: Q7Z7J9
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.