cAMP-dependent Protein Kinase Catalytic Subunit, Recombinant, Drosophila melanogaster, aa2-353, His-SUMO-Tag

Artikelnummer: USB-583880
Artikelname: cAMP-dependent Protein Kinase Catalytic Subunit, Recombinant, Drosophila melanogaster, aa2-353, His-SUMO-Tag
Artikelnummer: USB-583880
Hersteller Artikelnummer: 583880
Alternativnummer: USB-583880-20,USB-583880-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Serine/threonine-protein kinase involved in memory formation. Promotes long-term memory by phosphorylating meng and by regulating CrebB protein stability and activity. As part of ethanol response in the glia, mediates ethanol-induced structural remodeling of actin cytoskeleton and perineurial membrane topology when anchored to the membrane. Source: Recombinant protein corresponding to aa2-353 from Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~56.7kD Amino Acid Sequence: GNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56.7
UniProt: P12370
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.