Carbon Dioxide-concentrating Mechanism Protein CcmK Homolog 2, Recombinant, Synechocystis sp., aa2-103, His-Tag, Myc-Tag

Artikelnummer: USB-583907
Artikelname: Carbon Dioxide-concentrating Mechanism Protein CcmK Homolog 2, Recombinant, Synechocystis sp., aa2-103, His-Tag, Myc-Tag
Artikelnummer: USB-583907
Hersteller Artikelnummer: 583907
Alternativnummer: USB-583907-20,USB-583907-100
Hersteller: US Biological
Kategorie: Molekularbiologie
One of the shell proteins of the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, rbcL-rbcS) is sequestered. The central pore probably regulates metabolite flux. Hexamers make sheets that form the facets of the polyhedral carboxysome (Probable). Source: Recombinant protein corresponding to aa2-103 from Synechocystis sp. Carbon dioxide-concentrating mechanism protein CcmK homolog 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~18.4kD Amino Acid Sequence: SIAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIRYTEEVEQFRTY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.4
UniProt: P72761
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.