Cathelicidin Antimicrobial Peptide, Recombinant, Human, aa132-170, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-583930
Artikelname: Cathelicidin Antimicrobial Peptide, Recombinant, Human, aa132-170, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-583930
Hersteller Artikelnummer: 583930
Alternativnummer: USB-583930-20,USB-583930-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Source: Recombinant protein corresponding to aa132-170 from human Cathelicidin antimicrobial peptide, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~24.7kD Amino Acid Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.7
UniProt: P49913
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.