CB1 Cannabinoid Receptor-interacting Protein 1, Recombinant, Mouse, aa1-464, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: CB1 Cannabinoid Receptor-interacting Protein 1, Recombinant, Mouse, aa1-464, His-Tag, Myc-Tag
• Artikelnummer: USB-583941
• Hersteller Artikelnummer: 583941
• Alternativnummer: USB-583941-20
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels. Source: Recombinant protein corresponding to aa1-464 from mouse CB1 cannabinoid receptor-interacting protein 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~22.6kD Amino Acid Sequence: MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.6
• UniProt: Q5M8N0
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.