CCAAT/enhancer-binding Protein Delta, Recombinant, Human, aa2-269, His-Tag, Myc-Tag

Artikelnummer: USB-583942
Artikelname: CCAAT/enhancer-binding Protein Delta, Recombinant, Human, aa2-269, His-Tag, Myc-Tag
Artikelnummer: USB-583942
Hersteller Artikelnummer: 583942
Alternativnummer: USB-583942-20,USB-583942-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcription activator that recognizes two different DNA motifs. Source: Recombinant protein corresponding to aa2-269 from human CCAAT/enhancer-binding protein delta, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~35.8kD Amino Acid Sequence: SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.8
UniProt: P49716
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol