cDNA FLJ56323, Highly Similar to Methylated-DNA--Protein-Cysteine Methyltransferase, Recombinant, Human, aa4-238, His-Tag

Artikelnummer: USB-583952
Artikelname: cDNA FLJ56323, Highly Similar to Methylated-DNA--Protein-Cysteine Methyltransferase, Recombinant, Human, aa4-238, His-Tag
Artikelnummer: USB-583952
Hersteller Artikelnummer: 583952
Alternativnummer: USB-583952-20,USB-583952-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa4-238 from human cDNA FLJ56323, highly similar to Methylated-DNA--protein-cysteinemethyltransferase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.7kD Amino Acid Sequence: QPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.7
UniProt: B4DEE8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.