Cecropin-D, Recombinant, Bombyx mori, aa25-60, His-Tag

Artikelnummer: USB-583953
Artikelname: Cecropin-D, Recombinant, Bombyx mori, aa25-60, His-Tag
Artikelnummer: USB-583953
Hersteller Artikelnummer: 583953
Alternativnummer: USB-583953-20,USB-583953-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Source: Recombinant protein corresponding to aa25-60 from bombyx mori Cecropin-D, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~7.8kD Amino Acid Sequence: GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 7.8
UniProt: O76146
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.