CFA/I Fimbrial Subunit B, Recombinant, E. coli, aa24-170, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-583971
Artikelname: CFA/I Fimbrial Subunit B, Recombinant, E. coli, aa24-170, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-583971
Hersteller Artikelnummer: 583971
Alternativnummer: USB-583971-20,USB-583971-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. Source: Recombinant protein corresponding to aa24-170 from Escherichia coli CFA/I fimbrial subunit B, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~31.1kD Amino Acid Sequence: VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.1
UniProt: P0CK93
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.