cGMP-specific 3,5-cyclic Phosphodiesterase, Recombinant, Mouse, aa154-320, His-Tag, Myc-Tag

Artikelnummer: USB-583972
Artikelname: cGMP-specific 3,5-cyclic Phosphodiesterase, Recombinant, Mouse, aa154-320, His-Tag, Myc-Tag
Artikelnummer: USB-583972
Hersteller Artikelnummer: 583972
Alternativnummer: USB-583972-20,USB-583972-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5-GMP. Specifically regulates nitric-oxide-generated cGMP. Source: Recombinant protein corresponding to aa154-320 from mouse cGMP-specific 3,5-cyclic phosphodiesterase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~26.1kD Amino Acid Sequence: DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.1
UniProt: Q8CG03
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol