Chitin-binding Lectin, Recombinant, Viscum album, aa1-49, His-Tag

Artikelnummer: USB-583983
Artikelname: Chitin-binding Lectin, Recombinant, Viscum album, aa1-49, His-Tag
Artikelnummer: USB-583983
Hersteller Artikelnummer: 583983
Alternativnummer: USB-583983-20,USB-583983-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Chitin-binding lectin which is specific for N-acetylglucosamine oligomers. Source: Recombinant protein corresponding to aa1-49 from Viscum album Chitin-binding lectin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~11.4kD Amino Acid Sequence: IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.4
UniProt: P81859
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.