Chitinase-3-like Protein 4, Recombinant, Mouse, aa22-402, His-Tag

Produktübersicht

• Artikelname: Chitinase-3-like Protein 4, Recombinant, Mouse, aa22-402, His-Tag
• Artikelnummer: USB-583991
• Hersteller Artikelnummer: 583991
• Alternativnummer: USB-583991-20,USB-583991-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has low chemotactic activity for eosinophils. May play a role in inflammation and allergy. Has no chitinase activity. Source: Recombinant protein corresponding to aa22-402 from mouse Chitinase-3-like protein 4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~44.9kD Amino Acid Sequence: YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 44.9
• UniProt: Q91Z98
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.