Plays a major role in tight junction-specific obliteration of the intercellular space. Source: Partial recombinant protein corresponding to aa1-82 from human Claudin-6, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Swiss/UniProt Accession: P56747. Molecular Weight: ~24.8kD Amino Acid Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
