Cold Shock Protein CspA, Recombinant, Salmonella enteritidis, aa2-70, His-Tag, Myc-Tag
Artikelnummer:
USB-584033
Hersteller Artikelnummer:
584033
Alternativnummer:
USB-584033-20,USB-584033-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Binds to and stimulates the transcription of the CCAAT-containing, cold-shock-inducible promoters of the H-NS and GyrA proteins. Binds also to the inverted repeat 5-ATTGG-3. Source: Recombinant protein corresponding to aa2-70 from Salmonella enteritidis Cold shock protein CspA, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.7kD Amino Acid Sequence: SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten