Complement Receptor Type 2, Recombinant, Mouse, aa12-145, His-Tag

Artikelnummer: USB-584083
Artikelname: Complement Receptor Type 2, Recombinant, Mouse, aa12-145, His-Tag
Artikelnummer: USB-584083
Hersteller Artikelnummer: 584083
Alternativnummer: USB-584083-20,USB-584083-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. Source: Recombinant protein corresponding to aa12-145 from mouse Complement receptor type 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.7kD Amino Acid Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.7
UniProt: P19070
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.