Cone-rod Homeobox Protein, Recombinant, Human, aa24-121, GST-Tag

Artikelnummer: USB-584088
Artikelname: Cone-rod Homeobox Protein, Recombinant, Human, aa24-121, GST-Tag
Artikelnummer: USB-584088
Hersteller Artikelnummer: 584088
Alternativnummer: USB-584088-20,USB-584088-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli. Source: Recombinant protein corresponding to aa24-121 from human Cone-rod homeobox protein, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.9kD Amino Acid Sequence: SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.9
UniProt: O43186
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.