Contactin-associated Protein-like 2, Recombinant, Human, aa35-181, His-Tag

Artikelnummer: USB-584092
Artikelname: Contactin-associated Protein-like 2, Recombinant, Human, aa35-181, His-Tag
Artikelnummer: USB-584092
Hersteller Artikelnummer: 584092
Alternativnummer: USB-584092-20,USB-584092-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for gap junction formation (Probable). Required, with CNTNAP1, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the juxtaparanodal region of the axo-glial junction. Source: Recombinant protein corresponding to aa35-181 from human Contactin-associated protein-like 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.4kD Amino Acid Sequence: CDEPLVSGLPHGAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPVIARYVRVVPLDWNGEGRIGLRIEVYGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.4
UniProt: Q9UHC6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.