Cyanovirin-N Homolog, Recombinant, Ceratopteris richardii, aa28-142, His-Tag

Artikelnummer: USB-584115
Artikelname: Cyanovirin-N Homolog, Recombinant, Ceratopteris richardii, aa28-142, His-Tag
Artikelnummer: USB-584115
Hersteller Artikelnummer: 584115
Alternativnummer: USB-584115-20,USB-584115-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mannose-binding lectin. Source: Recombinant protein corresponding to aa28-142 from Ceratopteris richardii Cyanovirin-N homolog, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.9kD Amino Acid Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.9
UniProt: P86326
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol