Cyclin-dependent Kinase Inhibitor 3, Recombinant, Human, aa1-212, His-Tag

Artikelnummer: USB-584125
Artikelname: Cyclin-dependent Kinase Inhibitor 3, Recombinant, Human, aa1-212, His-Tag
Artikelnummer: USB-584125
Hersteller Artikelnummer: 584125
Alternativnummer: USB-584125-20,USB-584125-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at Thr-160 in a cyclin-dependent manner. Source: Recombinant protein corresponding to aa1-212 from human Cyclin-dependent kinase inhibitor 3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.8kD Amino Acid Sequence: MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.8
UniProt: Q16667
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.