Cyclin-dependent Kinases Regulatory Subunit 2, Recombinant, Human, aa1-79, His-Tag, Myc-Tag

Artikelnummer: USB-584127
Artikelname: Cyclin-dependent Kinases Regulatory Subunit 2, Recombinant, Human, aa1-79, His-Tag, Myc-Tag
Artikelnummer: USB-584127
Hersteller Artikelnummer: 584127
Alternativnummer: USB-584127-20,USB-584127-100,USB-584127-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. Recombinant protein corresponding to aa1-79 from human Cyclin-dependent kinases regulatory subunit 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~17.3kD Amino Acid Sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.3
UniProt: P33552
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.