Cystathionine beta-synthase, Recombinant, Saccharomyces cerevisiae, aa1-345, His-Tag

Artikelnummer: USB-584131
Artikelname: Cystathionine beta-synthase, Recombinant, Saccharomyces cerevisiae, aa1-345, His-Tag
Artikelnummer: USB-584131
Hersteller Artikelnummer: 584131
Alternativnummer: USB-584131-20,USB-584131-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-345 from Saccharomyces cerevisiae Cystathionine beta-synthase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.0kD Amino Acid Sequence: MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42
UniProt: P32582
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.