Cysteine-rich Tail Protein 1, Recombinant, Human, aa1-184, His-B2M-JD-Tag

Produktübersicht

• Artikelname: Cysteine-rich Tail Protein 1, Recombinant, Human, aa1-184, His-B2M-JD-Tag
• Artikelnummer: USB-584139
• Hersteller Artikelnummer: 584139
• Alternativnummer: USB-584139-20,USB-584139-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-184 from human Cysteine-rich tail protein 1, fused to 10X His-B2M-JD-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.2kD Amino Acid Sequence: MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.2
• UniProt: B8A4K4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.