Cytadherence High Molecular Weight Protein 3, Recombinant, Mycoplasma pneumoniae, aa160-339, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Cytadherence High Molecular Weight Protein 3, Recombinant, Mycoplasma pneumoniae, aa160-339, His-Tag, Myc-Tag
• Artikelnummer: USB-584141
• Hersteller Artikelnummer: 584141
• Alternativnummer: USB-584141-20,USB-584141-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Component of the cytoskeleton-like structure which stabilizes the shape of the wall-less mycoplasma. This cytoskeleton-like network of accessory proteins containing HMW proteins 1 to 5 allows the proper anchoring of cytadhesin proteins in the mycoplasmal membrane at the attachment organelle. Essential for successful surface parasitism. Source: Recombinant protein corresponding to aa160-339 from Mycoplasma pneumoniae Cytadherence high molecular weight protein 3, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~27.1kD Amino Acid Sequence: PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 27.1
• UniProt: Q50360
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.