Cytochrome P450 11B1, Mitochondrial, Recombinant, Human, aa25-503, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-584146
Artikelname: Cytochrome P450 11B1, Mitochondrial, Recombinant, Human, aa25-503, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-584146
Hersteller Artikelnummer: 584146
Alternativnummer: USB-584146-20,USB-584146-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Source: Recombinant protein corresponding to aa25-503 from human Cytochrome P450 11B1, mitochondrial, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~74.9kD Amino Acid Sequence: GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 74.9
UniProt: P15538
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.