Cytochrome P460, Recombinant, Nitrosomonas Europaea, aa27-198, His-SUMO-Tag

Artikelnummer: USB-584155
Artikelname: Cytochrome P460, Recombinant, Nitrosomonas Europaea, aa27-198, His-SUMO-Tag
Artikelnummer: USB-584155
Hersteller Artikelnummer: 584155
Alternativnummer: USB-584155-20,USB-584155-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa27-198 from Nitrosomonas europaea Cytochrome P460, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.7kD Amino Acid Sequence: AGVAEFNDKGELLLPKNYREWVMVGTQVTPNELNDGKAPFTEIMTVYVDPESYAHWKKTGEFRDGTVTVKELVSVGDRKGPGSGNGYFMGDYIGLEASVKDSQRFANEPGNWAFYIFYVPDTPLVAAAKNLPTAECAACHKENAKTDMVFTQFYPVLRAAKATGESGVVAPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.7
UniProt: Q50927
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.