Cytokine-like Protein 1, Recombinant, Human, aa23-136, hFC-Tag

Produktübersicht

• Artikelname: Cytokine-like Protein 1, Recombinant, Human, aa23-136, hFC-Tag
• Artikelnummer: USB-584162
• Hersteller Artikelnummer: 584162
• Alternativnummer: USB-584162-20,USB-584162-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa23-136 from human Cytokine-like protein 1, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~40.8kD Amino Acid Sequence: TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 40.8
• UniProt: Q9NRR1
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.