Cytoplasmic Envelopment Protein 3, Recombinant, Human Cytomegalovirus, aa2-190, His-Tag

Produktübersicht

• Artikelname: Cytoplasmic Envelopment Protein 3, Recombinant, Human Cytomegalovirus, aa2-190, His-Tag
• Artikelnummer: USB-584168
• Hersteller Artikelnummer: 584168
• Alternativnummer: USB-584168-20,USB-584168-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa2-190 from human cytomegalovirus Cytoplasmic envelopment protein 3, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.8kD Amino Acid Sequence: GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 24.8
• UniProt: P13200
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.