Cytotoxic T-lymphocyte Protein 4, Recombinant, Human, aa37-162, His-Tag

Produktübersicht

• Artikelname: Cytotoxic T-lymphocyte Protein 4, Recombinant, Human, aa37-162, His-Tag
• Artikelnummer: USB-584171
• Hersteller Artikelnummer: 584171
• Alternativnummer: USB-584171-20,USB-584171-100,USB-584171-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Recombinant protein corresponding to aa37-162 from human Cytotoxic T-lymphocyte protein 4, fused to 6X His-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~17.6kD Amino Acid Sequence: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.6
• UniProt: P16410
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.