D-dopachrome Decarboxylase, Recombinant, Rat, aa2-118, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: D-dopachrome Decarboxylase, Recombinant, Rat, aa2-118, His-Tag, Myc-Tag
• Artikelnummer: USB-584182
• Hersteller Artikelnummer: 584182
• Alternativnummer: USB-584182-20,USB-584182-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Source: Recombinant protein corresponding to aa2-118 from rat D-dopachrome decarboxylase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.4kD Amino Acid Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 20.4
• UniProt: P80254
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.