Defensin-like Protein 16, Recombinant, Arabidopsis thaliana, aa30-80

Produktübersicht

• Artikelname: Defensin-like Protein 16, Recombinant, Arabidopsis thaliana, aa30-80
• Artikelnummer: USB-584193
• Hersteller Artikelnummer: 584193
• Alternativnummer: USB-584193-20,USB-584193-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Confers broad-spectrum resistance to pathogens. Has antifungal activity in vitro. Source: Recombinant protein corresponding to aa30-80 from Arabidopsis thaliana Defensin-like protein 16, expressed in E.coli. Molecular Weight: ~5.5kD Amino Acid Sequence: QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 5.5
• UniProt: Q9FI23
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.