Dehydrin Xero 1, Recombinant, Arabidopsis thaliana, aa1-128, His-SUMOSTAR-Tag

Produktübersicht

• Artikelname: Dehydrin Xero 1, Recombinant, Arabidopsis thaliana, aa1-128, His-SUMOSTAR-Tag
• Artikelnummer: USB-584201
• Hersteller Artikelnummer: 584201
• Alternativnummer: USB-584201-20,USB-584201-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-128 from Arabidopsis thaliana Dehydrin Xero 1, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.5kD Amino Acid Sequence: MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.5
• UniProt: P25863
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.