Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag

Artikelnummer: USB-584204
Artikelname: Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag
Artikelnummer: USB-584204
Hersteller Artikelnummer: 584204
Alternativnummer: USB-584204-20,USB-584204-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-193 from Arabidopsis thaliana Dehydrin Xero 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: MNSHQNQTGVQKKGITEKIMEKLPGHHGPTNTGVVHHEKKGMTEKVMEQLPGHHGATGTGGVHHEKKGMTEKVMEQLPGHHGSHQTGTNTTYGTTNTGGVHHEKKSVTEKVMEKLPGHHGSHQTGTNTAYGTNTNVVHHEKKGIAEKIKEQLPGHHGTHKTGTTTSYGNTGVVHHENKSTMDKIKEKLPGGHH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.4
UniProt: P42758
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol