Delta-like Protein 3, Recombinant, Human, aa383-492, His-SUMO-Tag
Artikelnummer:
USB-584206
Hersteller Artikelnummer:
584206
Alternativnummer:
USB-584206-20,USB-584206-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. Source: Recombinant protein corresponding to aa383-492 from human Delta-like protein 3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.2kD Amino Acid Sequence: FAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten